Protein Info for HER17_RS04505 in Pectobacterium carotovorum WPP14

Annotation: glycine betaine/L-proline ABC transporter ATP-binding protein ProV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 36 to 394 (359 residues), 570.3 bits, see alignment E=8.6e-176 PF00005: ABC_tran" amino acids 44 to 192 (149 residues), 123.1 bits, see alignment E=1.4e-39 PF00571: CBS" amino acids 345 to 392 (48 residues), 28.8 bits, see alignment 1.3e-10

Best Hits

Swiss-Prot: 88% identical to OUSV_DICD3: Glycine betaine/choline transport system ATP-binding protein OusV (ousV) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02000, glycine betaine/proline transport system ATP-binding protein [EC: 3.6.3.32] (inferred from 98% identity to pwa:Pecwa_3476)

MetaCyc: 80% identical to glycine betaine ABC transporter ATP binding subunit ProV (Escherichia coli K-12 substr. MG1655)
RXN-8638 [EC: 7.6.2.9]; 7.4.2.- [EC: 7.6.2.9]

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.32 or 7.6.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>HER17_RS04505 glycine betaine/L-proline ABC transporter ATP-binding protein ProV (Pectobacterium carotovorum WPP14)
MAIKLEVKNLYKIFGEHPDRAFKLIDKGLSKDQVFEKTGLTVGVKDASLAIEEGEIFVIM
GLSGSGKSTMVRLLNRLIEPTRGQVLIDGEDISRISDTALRDVRRKKISMVFQSFALMPH
LNILNNTAFGMELAGVPKAEREQKALDALQQVGLEAYAASYPDELSGGMRQRVGLARALA
NDPDILLMDEAFSALDPLIRTEMQDELIKLQSRHQRTIVFISHDLDEAMRIGDRIAIMHG
GEVIQVGTPDEILNNPANDYVRTFFRGVDISHVFSAKDIARRRPVTLIRKTPGVGPRSAL
KILQDEDRDYGYVLEGGKRFIGIVSIDSLKLALKEQQPLEQALLPEPVPVPADMSLNELI
SQVAQAPCAVPVIGENNEYIGIISKGMLLQALDKEGVTNE