Protein Info for HER17_RS04500 in Pectobacterium carotovorum WPP14

Annotation: glycine betaine/L-proline ABC transporter permease ProW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 156 to 178 (23 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 252 to 282 (31 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 223 to 391 (169 residues), 98.7 bits, see alignment E=1.7e-32

Best Hits

Swiss-Prot: 78% identical to OUSW_DICD3: Glycine betaine/choline transport system permease protein OusW (ousW) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 93% identity to pct:PC1_3321)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>HER17_RS04500 glycine betaine/L-proline ABC transporter permease ProW (Pectobacterium carotovorum WPP14)
MSKSTSNPWDATTAQNQPADQGTTSEQASGAQQNDPWAASSQNAPADSAPASAAQSDPWS
TGAPAQDAPANGGDAWSSAPAPDGSVDAAHQATQSGSDWLNSAAPATPEHFNLLDPFKDT
LIPLDSWVTHGIDWVVLHFRPIFQGVRVPVDFILGGFQQFLLGMPAPIAILVFSLIAWQM
SSLGMGVATLLSLIAIGAIGAWSQAMITLALVLTALFFCVLIGLPVGIWLARSERAAKFI
RPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIIRLTILGIRQVPADLIEA
AESFGASPRQMLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGR
LDMGLAAVGGVGIVILAIILDRLTQSLGRDRRSKGNKSWYASGPIGLLTRPFIKQ