Protein Info for HER17_RS03970 in Pectobacterium carotovorum WPP14

Annotation: hemolysin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 56 to 80 (25 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details PF01595: CNNM" amino acids 7 to 197 (191 residues), 146.7 bits, see alignment E=9.1e-47 PF00571: CBS" amino acids 283 to 333 (51 residues), 20.6 bits, see alignment 7e-08 PF03471: CorC_HlyC" amino acids 348 to 425 (78 residues), 77.8 bits, see alignment E=7.6e-26

Best Hits

Swiss-Prot: 78% identical to YTFL_ECOL6: UPF0053 inner membrane protein YtfL (ytfL) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 99% identity to pct:PC1_3418)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>HER17_RS03970 hemolysin family protein (Pectobacterium carotovorum WPP14)
MLNSLLLILCLIAISAFFSISEISLAASRKIKLKLMADEGNLNADLVLKFQETPGIFFTV
IQIGVNAVAILAGIIGDAAFSPTFSMLFERFMSPEAADKVSFICSFVLVTSLFILFGDLT
PKRIGMIAPETVAVRIINPMRFCLFLFRPLVWIFNGLANVIFRLLKLPMVRKDDITSDDI
YAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTSRESVVYFDLREQEDSIKEKIAQ
QPHSKFLVCDGTIDQIVGYVDSKDLLIRVLGNQSLTLSSGVQIRPALIVPDTLTLSEALE
SFKTAGEDFAVILNEYALIVGIITLNDVMTTLMGDLVGQGMEEQIVARDENSWLVEGGTP
IEDVMRALNIDDFPHSGNYETIGGFMMYTLRKIPKRTDAVRFSGYKFEVVDIDSYKIDQL
LVTRLEDRPIVSSSVKIDSDD