Protein Info for HER17_RS03830 in Pectobacterium carotovorum WPP14

Annotation: nitric oxide-sensing transcriptional repressor NsrR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00738: Rrf2 family protein
  • amino acids 1 to 129 (129 residues), 124.6 bits, E=1.2e-40
• PF02082: Rrf2
  • amino acids 3 to 130 (128 residues), 129.6 bits, E=4.5e-42

Best Hits

Swiss-Prot: 99% identical to NSRR_PECCP: HTH-type transcriptional repressor NsrR (nsrR) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K13771, Rrf2 family transcriptional regulator, nitric oxide-sensitive transcriptional repressor (inferred from 99% identity to eca:ECA3623)

Predicted SEED Role

"Nitrite-sensitive transcriptional repressor NsrR" in subsystem Nitrosative stress or Oxidative stress or Rrf2 family transcriptional regulators

Protein Sequence (141 amino acids)

>HER17_RS03830 nitric oxide-sensing transcriptional repressor NsrR (Pectobacterium carotovorum WPP14)
MQLTSFTDYGLRALIYMASLPGGKMTSISEVTEVYGVSRNHMVKIINQLSRAGLVMAVRG
KNGGIRLGKPAETIRIGDVVRELEPLTLVNCSHEFCHITPACRLKQVLQQAVQNFLHELD
QYTLADMVKENPPLYKLLLVE