Protein Info for HER17_RS02465 in Pectobacterium carotovorum WPP14

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF00005: ABC_tran" amino acids 42 to 180 (139 residues), 115.6 bits, see alignment E=2.8e-37

Best Hits

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 97% identity to eca:ECA3954)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.25

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>HER17_RS02465 ABC transporter ATP-binding protein (Pectobacterium carotovorum WPP14)
MMTPRTAQVEKPDTALPPYPAPNTHVTIRGLNKSFAGQPLYTDLNLDLPRGKIVSIFGPN
GCGKSTLMNMIAGLIPVDSGDILFDGKTLSETKIGYVFQNYRDALFPWMSAWKNIAYPLV
RSGMSKHDVQTRMDELIAMFDIRFDLQRYPYELSGGQQQTVCIMRALATGPEVMFLDEPF
SALDFEMTLFIRDKLQEVQLATGVTMVIVSHDLEDAVFLADEILLLTRRPTTVSEIVPFD
LARPRGAEAMSDPEFIRVKAHTLEVFKREMAA