Protein Info for HER17_RS02295 in Pectobacterium carotovorum WPP14

Annotation: isocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 TIGR01346: isocitrate lyase" amino acids 9 to 256 (248 residues), 389.3 bits, see alignment E=1.2e-120 amino acids 257 to 435 (179 residues), 298.6 bits, see alignment E=3.8e-93 PF00463: ICL" amino acids 9 to 256 (248 residues), 203 bits, see alignment E=7.9e-64 amino acids 257 to 435 (179 residues), 167.5 bits, see alignment E=4.4e-53 PF13714: PEP_mutase" amino acids 82 to 281 (200 residues), 55 bits, see alignment E=9.6e-19

Best Hits

Swiss-Prot: 87% identical to ACEA_SALTY: Isocitrate lyase (aceA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 99% identity to pct:PC1_3778)

MetaCyc: 87% identical to isocitrate lyase (Escherichia coli K-12 substr. MG1655)
Isocitrate lyase. [EC: 4.1.3.1]

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>HER17_RS02295 isocitrate lyase (Pectobacterium carotovorum WPP14)
MTTSRTQQVQHIEKEWKTARWEGITRPYSAEDVINLRGSVNPECTLAQLGAARLWNLLHG
DSRKGYVNCLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPA
VIERINNTFRRADQIQWANRIEPGDKRYTDYFLPIVADAEAGFGGVLNAFELMKSMIEAG
AAAVHFEDQLASAKKCGHMGGKVLVPTQEAVQKLVAARLAADVLGVPTLLVARTDADAAD
LLTSDCDEYDRDFITGERTVEGFYRTRAGIEQAISRGLAYAPYADLVWCETSTPDLSLAR
HFAEAIHAKFPGKLLAYNCSPSFNWKKNLDDSTIARFQDELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMRHYVEKVQQPEFEAIKDGYTFSSHQQEVGTGYFDKVTNIIQGGE
SSVTALTGSTEEQQF