Protein Info for HER17_RS01660 in Pectobacterium carotovorum WPP14

Annotation: IucA/IucC family siderophore biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 632 PF04183: IucA_IucC" amino acids 178 to 419 (242 residues), 181.1 bits, see alignment E=2.7e-57 PF06276: FhuF" amino acids 442 to 613 (172 residues), 117.9 bits, see alignment E=6.5e-38

Best Hits

Swiss-Prot: 48% identical to Y4XN_SINFN: Uncharacterized protein y4xN (NGR_a00750) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 93% identity to pct:PC1_3906)

Predicted SEED Role

"Siderophore biosynthesis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (632 amino acids)

>HER17_RS01660 IucA/IucC family siderophore biosynthesis protein (Pectobacterium carotovorum WPP14)
MNIKADDVKNRDIHQDVDDFLSDYSNKNALRRLIRCFFAEGILNKNDLMFIKDNSRKATL
TLQGGKGILKFDDISPSPANTYINNGNIYHINSDGASFPVTSHERLIDLLRDSFDFHPED
SGINGLKKDVGNSIRNDTNARRYRCQWRAEVADAMQQDGQNAFTPWLRRQLSIRDAAMFL
DQWGSLEGHPYYPTWKSRPGLSDEDVQQLSPEFNARVPLRITALRRDMAYVECMPHVDDF
HQWFAQAFPALWLDWKQRLNQQGLDETQWLPLPIHSWHLENWVKSHYADEIAEGILLTDG
PDLITLPGMSFRTVLPVEPSSSPFIKLPVAIWMTSEMRSLQAKSIQMGPRISTIIEAILA
QEGGFEQRLAFFREETAFHYKHAVHQDDAPGKHLSVVFRDARVYERTDGALPVTVATLFT
ALPHRDQPLFTELVTLSGLGAEAWFRQYVRAVTRPVIAIYLLYGIGLEAHQQNSQILFSP
EGVAQGLLIRDFGDGRTYAPLLRQRGHHLQPYVWPGILPTVFEDDIEPVRMFVVDACFVS
HLHELALALSAEYGFADARLWQVMKEETAAAFDAVKSRVDGELWQTERDMFLTQPWYTRS
LLRMHIQEYRDYRIQHGLSNPFLTEGETRVEP