Protein Info for HER17_RS00520 in Pectobacterium carotovorum WPP14

Annotation: PLP-dependent aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 PF00155: Aminotran_1_2" amino acids 46 to 392 (347 residues), 131.6 bits, see alignment E=4.3e-42 PF12897: Asp_aminotransf" amino acids 120 to 252 (133 residues), 36.8 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: None (inferred from 97% identity to eca:ECA4336)

Predicted SEED Role

"Aromatic-amino-acid aminotransferase (EC 2.6.1.57)" in subsystem Homogentisate pathway of aromatic compound degradation (EC 2.6.1.57)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.57

Use Curated BLAST to search for 2.6.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>HER17_RS00520 PLP-dependent aminotransferase family protein (Pectobacterium carotovorum WPP14)
MAIEGLLAHRIAQLKSSAIRELLKHSKMENIISLAGGIPSDALFDFEGLSQATQLAITEQ
PKTAFQYGLTEGSGVLRDRIAELCAVRGVKTRGDDIVVTAGSQQALDLIMRAMVDPGDVF
VVERPTYLAALQTLELAQAQVMSVSSDADGMVVDELEELLKKQRIKGVYIVPNFGNPSGV
TLSYERRLKLIQLAERYGFVIIEDDPYGELRFTEERNPTLFQLAQEQLGSTEYVLYTSTF
SKVLAPGLRLGWAILPDWLLHKVAIIKQAADLHASALSQTVAECYLGLGRLDTQIEKIRH
AYKHKGELLAQLVEKELGDVITFNQPKGGMFLWAKFRQDDFNTTEWLKKTLEQGVVFVPG
EFFFPDNIDYSTLRLSFATATDEQMHEAVARLRRAL