Protein Info for HEPCGN_26380 in Escherichia coli ECOR38

Name: espR1
Annotation: Type III secretion system effector espR1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 100% identity to ect:ECIAI39_1732)

Predicted SEED Role

"internalin, putative" in subsystem Listeria surface proteins: Internalin-like proteins

Protein Sequence (418 amino acids)

>HEPCGN_26380 Type III secretion system effector espR1 (Escherichia coli ECOR38)
MKFPSIFNKINPQSIQQHPEKNELNWMLELNQWKAERILTGEIHRPECRNEAAKRINCAF
LSKQNDIDLSGLNLTTQPPGLQNFTSINLDNNQLTHFDTTTYDRLVKLSLNSNALESINF
PQGRNVSITHISMNNNSLRNIDIDRLSSITYFSAAHNQLEFVQLECCERLQYLNLSHNQL
TDIVAGNKDELLLLDLSHNKLTSLHNALFPNLNTLLINNNLLSEIKIFFSNFCNVQTLNA
ANNQLEKINLHFLTYLSSIKSLRLDNNKITRIDTKNTSDIGTLFPIIKQSKNLNFLNVSG
QNNCPTMQLMLFNLFSPALKLNTGLAILSPGAFEVHSDGVDVDNELFHYTIKEAYTPYNI
HTYKTEEVVNQMNIKIKNMTLDEINNTYCNNDYYNEAIREEPIDFLDRSFSSSSWPFQ