Protein Info for HEPCGN_24355 in Escherichia coli ECOR38

Name: nohA
Annotation: P21 prophage-derived terminase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF07471: Phage_Nu1" amino acids 1 to 163 (163 residues), 247.9 bits, see alignment E=2.2e-78

Best Hits

Swiss-Prot: 100% identical to TERS_ECOL6: P21 prophage-derived terminase small subunit (nohA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 98% identity to sbc:SbBS512_E1453)

Predicted SEED Role

"Terminase small subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>HEPCGN_24355 P21 prophage-derived terminase small subunit (Escherichia coli ECOR38)
MKVNKKRLAEIFNVDPRTIERWQSQGLPCASKGSKGIESVFDTAMAIQWYAQRETDIENE
KLRKELDDLRAAAESDLQPGTIDYERYRLTKAQADAQELKNAREDGVVLETELFTFILQR
VAQEISGILVRVPLTLQRKYPDISPSHLDVVKTEIAKASNVAAKAGENVGGWIDDFRRAE
GS