Protein Info for HEPCGN_22995 in Escherichia coli ECOR38

Name: ycaN
Annotation: Uncharacterized HTH-type transcriptional regulator YcaN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00126: HTH_1" amino acids 7 to 63 (57 residues), 72.3 bits, see alignment E=2.6e-24 PF03466: LysR_substrate" amino acids 91 to 290 (200 residues), 113.8 bits, see alignment E=7.3e-37

Best Hits

Swiss-Prot: 98% identical to YCAN_ECOLI: Uncharacterized HTH-type transcriptional regulator YcaN (ycaN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ect:ECIAI39_2248)

Predicted SEED Role

"Putative LysR-like transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>HEPCGN_22995 Uncharacterized HTH-type transcriptional regulator YcaN (Escherichia coli ECOR38)
MRMNMSDFATFFAVARNQSFRAAGDELGLTSSAISHNIKTLEQRLKIRLFNRTTRSVSLT
EAGSNLYERLRPAFDEIQIMLDEMNDFRLTPTGTLKINAARVAARIFLMPLLVGFTREYP
DIKVELTTDDSLVDIVQQGFDAGVRLSGIVEKDMISVAIGPPVKLCVAATPEYFARYGKP
RHPHDLLNHQCVVFRYPSGKPFHWQFAKELKIAVAGNIILDDVDAELDAVLMGAGIGYLL
YEQIKEYLDTGRLECVLEDWITERPGFQIYYPNRQYMSCGLRAFLDYVKTGQICQSQRHR
PQ