Protein Info for HEPCGN_22510 in Escherichia coli ECOR38

Name: napF
Annotation: ferredoxin-type protein NapF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 TIGR00402: ferredoxin-type protein NapF" amino acids 7 to 157 (151 residues), 247.9 bits, see alignment E=1.7e-78 PF12838: Fer4_7" amino acids 36 to 81 (46 residues), 33 bits, see alignment E=3.5e-11 amino acids 109 to 155 (47 residues), 30.4 bits, see alignment E=2.2e-10 PF12800: Fer4_4" amino acids 36 to 48 (13 residues), 15 bits, see alignment (E = 1.3e-05) amino acids 140 to 153 (14 residues), 17.3 bits, see alignment (E = 2.5e-06) PF13187: Fer4_9" amino acids 36 to 82 (47 residues), 32.5 bits, see alignment E=3.6e-11 PF12798: Fer4_3" amino acids 69 to 81 (13 residues), 13.8 bits, see alignment (E = 4.7e-05) amino acids 141 to 155 (15 residues), 14.5 bits, see alignment (E = 2.7e-05) PF00037: Fer4" amino acids 136 to 157 (22 residues), 29.2 bits, see alignment (E = 3e-10)

Best Hits

Swiss-Prot: 99% identical to NAPF_ECOLI: Ferredoxin-type protein NapF (napF) from Escherichia coli (strain K12)

KEGG orthology group: K02572, ferredoxin-type protein NapF (inferred from 99% identity to eco:b2208)

Predicted SEED Role

"Ferredoxin-type protein NapF (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>HEPCGN_22510 ferredoxin-type protein NapF (Escherichia coli ECOR38)
VKIDASRRGILTGRWRKASNGIRPPWSGDESHFLTHCTRCDACINACENNILQRGAGGYP
SVNFKNNECSFCYACAQACPESLFSPRHTRAWDLQFTIGDACLAYQSVECRRCQDSCEPM
AIIFRPTLSGIYQPQLNSQLCNGCGACAASCPVSAITAEYLHAH