Protein Info for HEPCGN_19795 in Escherichia coli ECOR38

Name: hycH
Annotation: formate hydrogenlyase assembly protein HycH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 PF07450: HycH" amino acids 4 to 133 (130 residues), 199.4 bits, see alignment E=1.3e-63

Best Hits

Swiss-Prot: 98% identical to HYCH_ECOLI: Formate hydrogenlyase maturation protein HycH (hycH) from Escherichia coli (strain K12)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 98% identity to eco:b2718)

Predicted SEED Role

"Formate hydrogenlyase maturation protein HycH"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (136 amino acids)

>HEPCGN_19795 formate hydrogenlyase assembly protein HycH (Escherichia coli ECOR38)
MSEKVVFSQLSRKFIDENDATPAEAQQVVYYSLAIGHHLGVIDCLEAALTCPWDEYLAWI
ATLEAGSEARRKMEGVPKYGEIVIDINHVPMLANAFDKARAAQTSQQKEWSTMLLSMLHD
IYQENAIYLMVRRLRD