Protein Info for HEPCGN_18525 in Escherichia coli ECOR38

Annotation: TRAP transporter large permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 6 to 39 (34 residues), see Phobius details amino acids 59 to 84 (26 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 140 to 166 (27 residues), see Phobius details amino acids 174 to 198 (25 residues), see Phobius details PF06808: DctM" amino acids 10 to 199 (190 residues), 185.3 bits, see alignment E=9e-59

Best Hits

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (213 amino acids)

>HEPCGN_18525 TRAP transporter large permease subunit (Escherichia coli ECOR38)
MDSYIALTLFGCFFVLVFIGVPISFSIGIATVASMLLMFPWDIAAITVSQRLANGLDNFA
LLAIPFFIFAGTLMNSGGIAIRLINLAQVMVGRVPGSLGHVNVLANMMFGSISGSAVAAA
AAVGGTLNPIQTKEGYDPAFSTAVNVSSCITGLLIPPSNVLIVFSLTAGGVSVASLFMAG
YLPGILMGLAVMIVCGIIEPPRESWRLNFLRKR