Protein Info for HEPCGN_11785 in Escherichia coli ECOR38

Annotation: phage tail protein I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 PF09684: Tail_P2_I" amino acids 9 to 115 (107 residues), 89.7 bits, see alignment E=8.3e-30 TIGR01634: phage tail protein I" amino acids 37 to 112 (76 residues), 37.4 bits, see alignment E=1.1e-13

Best Hits

Predicted SEED Role

"Putative phage tail protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (119 amino acids)

>HEPCGN_11785 phage tail protein I (Escherichia coli ECOR38)
MDKLLPPPPLASDERFSILANIAAERFAQLDLTALMVYLVDLVDASALPALAEQFHVQGL
EGWLFTTDEREKRELIKQAIELHKYKGTIWAVRRVLEILSLPGTISEWFEYGGKAYFLR