Protein Info for HEPCGN_10185 in Escherichia coli ECOR38
Name: chpS
Annotation: type II toxin-antitoxin system antitoxin ChpS
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 95% identical to CHPS_ECOLI: Antitoxin ChpS (chpS) from Escherichia coli (strain K12)
KEGG orthology group: None (inferred from 100% identity to ecm:EcSMS35_4702)MetaCyc: 95% identical to ChpS antitoxin of the ChpB-ChpS toxin-antitoxin system (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Programmed cell death antitoxin ChpS" in subsystem MazEF toxin-antitoxing (programmed cell death) system
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (83 amino acids)
>HEPCGN_10185 type II toxin-antitoxin system antitoxin ChpS (Escherichia coli ECOR38) MRITIKRWGNSSGMVIPNVVMKELNLRPGQSVEAQVSNNQLILTPISRRYSLDELLAQCD MNATELSEQDVWGKSTPAGDEIW