Protein Info for HEPCGN_10010 in Escherichia coli ECOR38

Annotation: DUF898 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 24 to 48 (25 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details PF05987: DUF898" amino acids 13 to 374 (362 residues), 192.7 bits, see alignment E=4.9e-61

Best Hits

Swiss-Prot: 65% identical to YJGN_SALTY: Inner membrane protein YjgN (yjgN) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to ect:ECIAI39_4730)

Predicted SEED Role

"Inner membrane protein YjgN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>HEPCGN_10010 DUF898 domain-containing protein (Escherichia coli ECOR38)
MNDVNIGKDNSRHSFVFTGKGGEYFLICLVNFLLTIITLGIYGPWALIKCRRYIYQHVTL
KGQPFSYKGTGGAIFVSMLLIVVVYLLSISCFAGQHFALGLFLFALLICGIPCMAVKSLQ
YQANMTSLNDIRFGFNCSMMRAWWVMLGLPVLLALVFWFALYLIAQVTTSIGGLFFNLVA
LSLLSAIGLGVVHGITYSKWMPLLGNNATFGIHKFSIQVNVKECIKGCMLAILTMVPFII
VIGIMIAPVFQQLMMMTMLGRSDAGSEFVLQYYPQIMASYFLYFVAILVFASYLYVTLRN
LFLNNLTLANGTIRFHSSVTAIGMFLRMLAVLMGSSVTCGLAYPWLKMWMVSWIANNTHV
QGNLDSLELTNDDKPQDSGSLMWISRGIMPYVPFI