Protein Info for HEPCGN_07210 in Escherichia coli ECOR38

Name: rdgC
Annotation: recombination-associated protein RdgC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF04381: RdgC" amino acids 24 to 322 (299 residues), 418 bits, see alignment E=1.1e-129

Best Hits

Swiss-Prot: 100% identical to RDGC_ECOLC: Recombination-associated protein RdgC (rdgC) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K03554, recombination associated protein RdgC (inferred from 100% identity to ebd:ECBD_3268)

Predicted SEED Role

"DNA recombination-dependent growth factor C" in subsystem CBSS-562.2.peg.5158 SK3 including or DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>HEPCGN_07210 recombination-associated protein RdgC (Escherichia coli ECOR38)
MQARRQFVIMPAKFNDKAVEIIMLWFKNLMVYRLSREISLRAEEMEKQLASMAFTPCGSQ
DMAKMGWVPPMGSHSDALTHVANGQIVICARKEEKILPSPVIKQALEAKIAKLEAEQARK
LKKTEKDSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSL
GSLPVVPLSMENPIELTLTEWVRSGSAAQGFQLLDEAELKSLLEDGGVIRAKKQDLTSEE
ITNHIEAGKVVTKLALDWQQRIQFVMCDDGSLKRLKFCDELRDQNEDIDREDFAQRFDAD
FILMTGELAALIQNLIEGLGGEAQR