Protein Info for HEPCGN_03430 in Escherichia coli ECOR38

Name: bcsA
Annotation: Glycosyl transferase family 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 178 to 195 (18 residues), see Phobius details amino acids 269 to 292 (24 residues), see Phobius details amino acids 305 to 328 (24 residues), see Phobius details amino acids 337 to 362 (26 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 34 to 200 (167 residues), 100 bits, see alignment E=2.2e-32 PF13641: Glyco_tranf_2_3" amino acids 34 to 253 (220 residues), 61.5 bits, see alignment E=1.5e-20 PF13632: Glyco_trans_2_3" amino acids 114 to 310 (197 residues), 41.9 bits, see alignment E=1.5e-14

Best Hits

Swiss-Prot: 98% identical to YAIP_ECOLI: Uncharacterized glycosyltransferase YaiP (yaiP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecp:ECP_1999)

Predicted SEED Role

"Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 2.7.7.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.24

Use Curated BLAST to search for 2.7.7.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>HEPCGN_03430 Glycosyl transferase family 2 (Escherichia coli ECOR38)
MKTLLFIFMTIAMLLWFLSTLRRKPCQKKGCIDAIIPAYNEGPCLAQSLDNLLRNPYFCR
VICVNDGSTDNTEAVMAEVKRKWGDRFVAVTQKNTGKGGALMHGLKYATCDQVFLSDADT
FVPPDNDGMGYMLAEIERGADAVGGIPSTALKGAGLLPHIRATVKLPMIVMKRTLQQFLG
GAPFIISGACGMFRTDVLRKFGFSDRTKVEDLDLTWTLVANGYRIRQANRCIVYPQECNS
PREEWRRWRRWIVGYAVCMRLHKRLLFSRFGIFSIFPMLLVVLYGVGIYLTTWFNEFITT
GPHGVVLAMFPLIWVGVVCVIGAFSAWFHRCWLLVPLAPLSVVYVLLAYAIWIIYGLIAF
FTGREPQRDKPTRYSALVEASTAYSQPSVTGTEKLSEA