Protein Info for HEPCGN_03255 in Escherichia coli ECOR38

Name: plaP
Annotation: putrescine/proton symporter PlaP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 285 to 312 (28 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details amino acids 361 to 383 (23 residues), see Phobius details amino acids 395 to 413 (19 residues), see Phobius details amino acids 419 to 437 (19 residues), see Phobius details PF00324: AA_permease" amino acids 23 to 413 (391 residues), 121.6 bits, see alignment E=3.9e-39 PF13520: AA_permease_2" amino acids 56 to 413 (358 residues), 116.6 bits, see alignment E=1.3e-37

Best Hits

Swiss-Prot: 100% identical to PLAP_ECOLI: Low-affinity putrescine importer PlaP (plaP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2014)

MetaCyc: 100% identical to putrescine:H+ symporter PlaP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-69

Predicted SEED Role

"Putrescine importer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>HEPCGN_03255 putrescine/proton symporter PlaP (Escherichia coli ECOR38)
MSHNVTPNTSRVELRKTLTLVPVVMMGLAYMQPMTLFDTFGIVSGLTDGHVPTAYAFALI
AILFTALSYGKLVRRYPSAGSAYTYAQKSISPTVGFMVGWSSLLDYLFAPMINILLAKIY
FEALVPSIPSWMFVVALVAFMTAFNLRSLKSVANFNTVIVVLQVVLIAVILGMVVYGVFE
GEGAGTLASTRPFWSGDAHVIPMITGATILCFSFTGFDGISNLSEETKDAERVIPRAIFL
TALIGGMIFIFATYFLQLYFPDISRFKDPDASQPEIMLYVAGKAFQVGALIFSTITVLAS
GMAAHAGVARLMYVMGRDGVFPKSFFGYVHPKWRTPAMNIILVGAIALLAINFDLVMATA
LINFGALVAFTFVNLSVISQFWIREKRNKTLKDHFQYLFLPMCGALTVGALWVNLEESSM
VLGLIWAAIGLIYLACVTKSFRNPVPQYEDVA