Protein Info for HEPCGN_03065 in Escherichia coli ECOR38

Name: manC
Annotation: mannose-1-phosphate guanylyltransferase ManC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 TIGR01479: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase" amino acids 6 to 477 (472 residues), 810.9 bits, see alignment E=1.7e-248 PF00483: NTP_transferase" amino acids 8 to 294 (287 residues), 238.7 bits, see alignment E=1.8e-74 PF12804: NTP_transf_3" amino acids 9 to 135 (127 residues), 33.1 bits, see alignment E=1.6e-11 PF22640: ManC_GMP_beta-helix" amino acids 301 to 354 (54 residues), 55.9 bits, see alignment 7.8e-19 PF01050: MannoseP_isomer" amino acids 359 to 473 (115 residues), 197.7 bits, see alignment E=1.3e-62 PF07883: Cupin_2" amino acids 390 to 457 (68 residues), 42.4 bits, see alignment E=1.2e-14

Best Hits

Swiss-Prot: 100% identical to MANC1_ECO57: Mannose-1-phosphate guanylyltransferase 1 (manC1) from Escherichia coli O157:H7

KEGG orthology group: K00971, mannose-1-phosphate guanylyltransferase [EC: 2.7.7.22] (inferred from 99% identity to eco:b2049)

MetaCyc: 99% identical to mannose-1-phosphate guanylyltransferase (Escherichia coli K-12 substr. MG1655)
Mannose-1-phosphate guanylyltransferase. [EC: 2.7.7.13]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.13 or 2.7.7.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>HEPCGN_03065 mannose-1-phosphate guanylyltransferase ManC (Escherichia coli ECOR38)
MAQSKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVIC
NEQHRFIVAEQLRQLNKLTENIILEPAGRNTAPAIALAALAAKRHSPENDPLMLVLAADH
VIADEDAFRAAVRNAMPYAEAGKLVTFGIVPDLPETGYGYIRRGEVSAGEQDAVAFEVAQ
FVEKPNLETAQAYVASGEYYWNSGMFLFRAGRYLEELKKYRPDILDACEKAMSAVDPDLD
FIRVDEEAFLACPEESVDYAVMERTADAVVVPMDAGWSDVGSWSSLWEISAHTAEGNVCH
GDVINHKTENSYVYAESGLVTTVGVKDLVVVQTKDAVLIADRNAVQDVKKVVEQIKADGR
HEHRVHREVYRPWGKYDSIDAGDRYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTAKVT
IDGDIKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFADRYGRV