Protein Info for HEPCGN_01940 in Escherichia coli ECOR38

Name: gsiC
Annotation: glutathione ABC transporter permease GsiC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 99 to 123 (25 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 87 (87 residues), 64 bits, see alignment E=1.4e-21 PF00528: BPD_transp_1" amino acids 113 to 304 (192 residues), 140.8 bits, see alignment E=4.3e-45

Best Hits

Swiss-Prot: 100% identical to GSIC_ECOUT: Glutathione transport system permease protein GsiC (gsiC) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: K13890, glutathione transport system permease protein (inferred from 100% identity to eco:b0831)

MetaCyc: 100% identical to glutathione ABC transporter membrane subunit GsiC (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>HEPCGN_01940 glutathione ABC transporter permease GsiC (Escherichia coli ECOR38)
MLNYVIKRLLGLIPTLFIVSVLVFLFVHMLPGDPARLIAGPEADAQVIELVRQQLGLDQP
LYHQFWHYISNAVQGDFGLSMVSRRPVADEIASRFMPTLWLTITSMVWAVIFGMAAGIIA
AVWRNRWPDRLSMTIAVSGISFPAFALGMLLIQVFSVELGWLPTVGADSWQHYILPSLTL
GAAVAAVMARFTRASFVDVLSEYYMRTARAKGVSETWVVLKHGLRNAMIPVVTMMGLQFG
FLLGGSIVVEKVFNWPGLGRLLVDSVEMRDYPVIQAEILLFSLEFILINLVVDVLYAAIN
PAIRYK