Protein Info for HEPCGN_00935 in Escherichia coli ECOR38

Name: holA
Annotation: DNA polymerase III subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR01128: DNA polymerase III, delta subunit" amino acids 18 to 332 (315 residues), 356.8 bits, see alignment E=5.5e-111 PF06144: DNA_pol3_delta" amino acids 21 to 140 (120 residues), 98 bits, see alignment E=6.1e-32 PF14840: DNA_pol3_delt_C" amino acids 214 to 338 (125 residues), 249.9 bits, see alignment E=7.5e-79 PF21694: DNA_pol3_delta_C" amino acids 215 to 316 (102 residues), 29.9 bits, see alignment E=7.3e-11

Best Hits

Swiss-Prot: 99% identical to HOLA_ECOLI: DNA polymerase III subunit delta (holA) from Escherichia coli (strain K12)

KEGG orthology group: K02340, DNA polymerase III subunit delta [EC: 2.7.7.7] (inferred from 100% identity to ect:ECIAI39_0615)

MetaCyc: 99% identical to DNA polymerase III subunit delta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA polymerase III delta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>HEPCGN_00935 DNA polymerase III subunit delta (Escherichia coli ECOR38)
MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAVRQVAAAQGFEEHHTFSIDPNTD
WNAIFSLCQAMSLFASRQTLLLLLPDNGPNAAINEQLLTLTGLLHDDLLLIVRGSKLSKA
QENAAWFTALANRSVQVTCQTPEQAQLPHWVAARAKQLNLELDDAANQVLCYCYEGNLLA
LAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALLMGKSKRALHILQQLRLEG
SEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQNRRGMMGEALNRLSQPQLRQ
AVQLLTRTELTLKQDYGQSVWAELEGLSLLLCHKPLADVFIDG