Protein Info for HEPCGN_00290 in Escherichia coli ECOR38

Annotation: TriB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details transmembrane" amino acids 56 to 77 (22 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details PF04956: TrbC" amino acids 20 to 105 (86 residues), 61.4 bits, see alignment E=4e-21

Best Hits

KEGG orthology group: K03197, type IV secretion system protein VirB2 (inferred from 100% identity to sbc:SbBS512_0036)

Predicted SEED Role

"FIG01068513: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>HEPCGN_00290 TriB protein (Escherichia coli ECOR38)
MSFKKSVCNCISSSVTAVMQRKNKVVMAVAGATVASPAFADGFSKAETLLQKVKTGLGGL
SLVTVTIACLWVGYKVLFGGSTIRECSPIIIGAIVIASAAEVASMMVN