Protein Info for GFF995 in Sphingobium sp. HT1-2

Annotation: Tol-Pal system beta propeller repeat protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 19 to 440 (422 residues), 424.1 bits, see alignment E=3e-131 PF04052: TolB_N" amino acids 28 to 140 (113 residues), 57.2 bits, see alignment E=2.5e-19 PF07676: PD40" amino acids 207 to 240 (34 residues), 19.6 bits, see alignment 1.1e-07 amino acids 250 to 284 (35 residues), 25.7 bits, see alignment 1.3e-09 amino acids 293 to 328 (36 residues), 43.3 bits, see alignment 3.8e-15 amino acids 381 to 416 (36 residues), 19.7 bits, see alignment 9.8e-08

Best Hits

Swiss-Prot: 70% identical to TOLB_SPHAL: Tol-Pal system protein TolB (tolB) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K03641, TolB protein (inferred from 89% identity to sch:Sphch_2050)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>GFF995 Tol-Pal system beta propeller repeat protein TolB (Sphingobium sp. HT1-2)
MTTTLLRRLAAATAALLAFTTMPALAQLSVDVTGDIDSNLKIAVPALPAQQDVATPAGTA
NELGRKIAEVIATDLKGSGLFDPSGPAGMPALAFPEVTNPIYDKWGAYQALVQGFVRTTG
GEADITVGCYLYDVALKQELTRQGYVVAPRDWRRAAHKCADAIYARLSGESPFFDSRIAY
IAESGPKDNRVKRLAIMDSDGANHRFITNGQSIALTPRFSPDYKSIVYVSYLGSRVRIYV
YDIGTGQQRLVTESNNTTFAPRWSPDGRNILFSMAVSGNTDIYRVSAQGGAPVRLTNSPG
IDVGGSYSPDGRQIVFESDRSGGQQIYVMNADGSNQRRISHGGGRYATPEWSPRGDLIAF
TKLSGDFKIAVMTPSGDNERILTNGWQDEQPTWSPNGRVLQFFRTTPGRQGSSQVWQVDL
TGVNERRIPTPLSGSDPAWGPLLP