Protein Info for GFF992 in Variovorax sp. SCN45

Annotation: 23S rRNA (adenine(2503)-C(2))-methyltransferase @ tRNA (adenine(37)-C(2))-methyltransferase (EC 2.1.1.192)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase
  • amino acids 3 to 354 (352 residues), 438.1 bits, E=1.1e-135
• PF21016: RlmN_N
  • amino acids 5 to 63 (59 residues), 87.8 bits, E=3.1e-29
• PF04055: Radical_SAM
  • amino acids 107 to 278 (172 residues), 51.2 bits, E=1.7e-17

Best Hits

Swiss-Prot: 83% identical to RLMN_ACIAC: Dual-specificity RNA methyltransferase RlmN (rlmN) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 96% identity to vap:Vapar_2184)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (382 amino acids)

>GFF992 23S rRNA (adenine(2503)-C(2))-methyltransferase @ tRNA (adenine(37)-C(2))-methyltransferase (EC 2.1.1.192) (Variovorax sp. SCN45)
MTTANLLEFDLEGLAAFCEKLGEKKFRATQLFRWIHQRGASDFTQMTDLAKSLREKLATT
ARVEALPVLTQHESKDGTIKWLFDVGDGNAVEAVFIPEDDRGTLCVSSQAGCAVGCRFCS
TGHQGFSRNLTTGEIVAQLWFAEHFLRKHLKRDERVISNVVMMGMGEPLQNYSALVPALR
TMLDDNAYGLSRRRVTVSTSGVVPMIDRLGTDCAVAMAVSLHAPNDALRDDLVPLNRKYP
IAELLEACKRYLAHAPRDFITFEYCMLDGVNDQPEHARQLIELVRTSGVSCKFNLIPFNP
FPASGLLRSPQPRVLAFAKMLSEAGLVTTVRKTRGDDIDAACGQLAGDVKDRTRAAERMA
QRRAAERPIVLHPVRKTLPQEH