Protein Info for GFF992 in Sphingobium sp. HT1-2

Annotation: Tol-Pal system protein TolQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 36 to 58 (23 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details TIGR02797: tonB-system energizer ExbB" amino acids 22 to 227 (206 residues), 206.2 bits, see alignment E=5.2e-65 TIGR02796: protein TolQ" amino acids 24 to 233 (210 residues), 258.7 bits, see alignment E=4.7e-81 PF01618: MotA_ExbB" amino acids 92 to 220 (129 residues), 127.1 bits, see alignment E=1.7e-41

Best Hits

KEGG orthology group: K03562, biopolymer transport protein TolQ (inferred from 92% identity to sjp:SJA_C1-34170)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>GFF992 Tol-Pal system protein TolQ (Sphingobium sp. HT1-2)
MNLSMPDVGTAMGAAADAATISPLALFLQADIVVKGVMLGLLLASIWTWAIIIGFSFTLR
KASKQSRAFEADFWKADDIDRFYEARGKAEFPAAKVMAAGVTEWRRSTAQKVIDRDGTRD
RLATSMSSTIAAEVDRLSDRLNILATVGSVAPFVGLFGTVWGIMRAFTSIAAAQNSSLAV
VAPGIAEALFATAIGLFAAIPAVIAYNRFSHGINRMESRLNRFADGFYATLSRELEAQR