Protein Info for GFF990 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 172 to 189 (18 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 299 to 322 (24 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 364 to 383 (20 residues), see Phobius details PF12832: MFS_1_like" amino acids 20 to 363 (344 residues), 150.7 bits, see alignment E=1.3e-47 PF07690: MFS_1" amino acids 23 to 348 (326 residues), 47.3 bits, see alignment E=2.9e-16 PF01306: LacY_symp" amino acids 25 to 163 (139 residues), 52.7 bits, see alignment E=6.2e-18 PF03825: Nuc_H_symport" amino acids 32 to 316 (285 residues), 38.1 bits, see alignment E=2e-13

Best Hits

KEGG orthology group: K05820, MFS transporter, PPP family, 3-phenylpropionic acid transporter (inferred from 69% identity to xau:Xaut_4111)

Predicted SEED Role

"Probable 3-phenylpropionic acid transporter" in subsystem Cinnamic Acid Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>GFF990 hypothetical protein (Xanthobacter sp. DMC5)
VDEAGENGQGHLPPRALALRLGAAYGTFFIALGIFQPYLPLWLQARGLGPEAMGLVLAVP
MLSRLAATPLLGLLSDRLGRPRALLTLLGMATVAAMVLLAFTSSLPAILLILGAMSAAWF
PGFSLLDSYTSRLARAGRAEYGRARQWGSASFLAANLAGGVIVGALGADSVVLLMIAGHV
AYVLATFALPELPRAEAMPSPLTGRRARLGFLAGIVAAGLVQASHAVLYLFATVHWRSEG
ISLTVIGVLWAVGVAAEMVLFRFGRPLLGRFGAYGMIAIGGAAAVVRFAVMASDPPLAVL
LPLQMLHALTFAATYLAMVDLVARGVSEHRSGTGQTTAAWTSSLMSSAANVAAGPLWAAF
GPMAFLAGCALGLAGAGVALVAARLQPQSKGSGGETVAPS