Protein Info for GFF988 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 129 to 148 (20 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 254 to 294 (41 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 127 to 370 (244 residues), 224.9 bits, see alignment E=7.1e-71 PF02405: MlaE" amino acids 158 to 368 (211 residues), 239.6 bits, see alignment E=2.8e-75

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 76% identity to azc:AZC_2213)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>GFF988 hypothetical protein (Xanthobacter sp. DMC5)
LPHASLISVHSQDDRLTVAGRGAWTSEYADELEMAVNDTVHSYAKPKGVEIDLASVERMD
TFGALLLERLRRAWAGTGVEPTLVGLAPRYKVLLEELSRMGHEPPPPKRRHEGILERFGH
EVVNAAKDALSLLNFIGATVAAMLRVLARPRSFRFTSMVNQVDRVGFRAVPIILLITFLI
GCILAQQGIFNFRRFGADIYVVDMVGVLVLRELGVLIVSIMIAGRSGSAYTAELGSMRMR
EEIDALRVMGFDPIEVLVVPRILALIIALPLLTFIGSMSAIFGAGLVSWGYGGITPDVFL
DRLKLAIDLDQFKVGMYKAPFMAATIGLVACMEGLRVGGSAESLGEHTTASVVKAIFLVI
VMDGVFAMFFAAIDM