Protein Info for PS417_05000 in Pseudomonas simiae WCS417

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 791 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF07660: STN" amino acids 46 to 96 (51 residues), 33.2 bits, see alignment 5.4e-12 PF07715: Plug" amino acids 139 to 236 (98 residues), 74.8 bits, see alignment E=1.1e-24 TIGR01783: TonB-dependent siderophore receptor" amino acids 140 to 791 (652 residues), 367.6 bits, see alignment E=7.4e-114 PF00593: TonB_dep_Rec_b-barrel" amino acids 311 to 759 (449 residues), 236.1 bits, see alignment E=2.2e-73

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 94% identity to pfs:PFLU1022)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2J0 at UniProt or InterPro

Protein Sequence (791 amino acids)

>PS417_05000 TonB-dependent receptor (Pseudomonas simiae WCS417)
MAVSGLALLPLSVAQAQEQQSARFNFALTAKPLPQALSDFSRVTGISVIYTDEAPYGLSA
PAVNGQMSATQALQRLLSNTGFTFRQIDARTLALEPVPTEGAVNLGATTISGVGQQVEDS
TSYQPPPTSSVMRSHALLLETPQTVNVVPAQVLRDQTPRNLDDALANISGITQANTLAST
QDAVMLRGFGDNRNGSIMRDGMPIVQGRALNATAERVEVLKGPSSLLYGIQDPGGVVNIV
SKKPELMRSTALTVRGSTFGDGKNGSGGSLDTTGPIGDSGLAYRLIVDHEDEDYWRNFGT
HRESLIAPSLAWYGDSTQLLFAYEHREFLTPFDRGTAIDPKTNHPLDIPATRRLDEPFNN
MEGRSDLYRFEADHDLNDDWKAHFGYSWNRETYDASQVRVSAVNANGTLTRKMDGTQGAI
TTDRFATASLEGKVNVFGLQNDVVFGLDDEYRKIYRADLIRQSSRATSFNYNNPVYGNEV
AGTTVSPADSAQTDLLRSDSLFFQDAIHLNEQWIFVAGARYQMYDQYAGKGVPFKANTNG
NGQAWVPRAGLVYRYTDELSFYGSYTESFKPNSTIAALADGSTLTGDLTPEESKSWELGA
KLDIPGRITASAALFNIDKRNVLVSVGSGANTVYSIAGQVRSRGLELDATGQLTDKVSLI
GSYAYTDALDVKDKDPTLEGNRLQNVAKHTGSLAVAYDFGNIFGGDQLRVGTGARYVGAR
AGDAANDFTLPGYTVADAFATYDTKIDGQKVKFQLNVKNMFDRVYYTSAASRLFVSMGDA
RQVSVSSTLEF