Protein Info for GFF98 in Sphingobium sp. HT1-2

Annotation: NAD(P)H-hydrate epimerase (EC 5.1.99.6) / ADP-dependent (S)-NAD(P)H-hydrate dehydratase (EC 4.2.1.136)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 228 to 246 (19 residues), see Phobius details TIGR00197: YjeF family N-terminal domain" amino acids 7 to 199 (193 residues), 118.2 bits, see alignment E=3.9e-38 PF03853: YjeF_N" amino acids 28 to 178 (151 residues), 104 bits, see alignment E=8.9e-34 TIGR00196: YjeF family C-terminal domain" amino acids 217 to 452 (236 residues), 162.5 bits, see alignment E=1.3e-51 PF01256: Carb_kinase" amino acids 228 to 442 (215 residues), 158.6 bits, see alignment E=1.9e-50

Best Hits

KEGG orthology group: None (inferred from 64% identity to sch:Sphch_0784)

Predicted SEED Role

"NAD(P)HX epimerase / NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>GFF98 NAD(P)H-hydrate epimerase (EC 5.1.99.6) / ADP-dependent (S)-NAD(P)H-hydrate dehydratase (EC 4.2.1.136) (Sphingobium sp. HT1-2)
MVPDPILTAAAMRAAEQAAFDAGVDPYELMERAGAAAAQIIWRAGHRRDALILCGPGNNG
GDGFVIARILRELGVPARVASLGDSRTASAQRARALWDGPVESLADAAPAAQLVDALFGT
GLTRGLDAAVADRLGELVAHANHSYAIDLPSGVGTDDGQLLSAVPKFDVTITLGAFKPAH
LLQPAASLMGKLVRADIGLSMPQDMHVLAPPRLRAPVAAAHKYSRGLVGVVGGLMPGAAA
LAAAAAAHSGAGMVRRYDASPCEARPHAIVHQQIEDETVLSDALSEARLAAVLVGPGLGR
EDGAQMRLDAALACKRPLVLDADALTLLAARAATHIPAGSILTPHQGEFVRLFGDLPGSK
IDRALAGARMTRSVVVYKGADSVIAAPDGQVAVARGASTWLSTAGTGDVLAGLVVGRLAV
TGDPFRAACEAVWLHGDAARRAGPAFVADDLLAALPAAIGSRL