Protein Info for GFF977 in Sphingobium sp. HT1-2

Annotation: Dihydroorotate dehydrogenase (quinone) (EC 1.3.5.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR01036: dihydroorotate dehydrogenase (fumarate)" amino acids 3 to 349 (347 residues), 382.7 bits, see alignment E=7e-119 PF01180: DHO_dh" amino acids 40 to 334 (295 residues), 257.8 bits, see alignment E=6.4e-81

Best Hits

Swiss-Prot: 63% identical to PYRD_SPHAL: Dihydroorotate dehydrogenase (quinone) (pyrD) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K00226, dihydroorotate dehydrogenase (fumarate) [EC: 1.3.98.1] (inferred from 81% identity to sch:Sphch_2034)

Predicted SEED Role

"Dihydroorotate dehydrogenase (EC 1.3.3.1)" in subsystem De Novo Pyrimidine Synthesis (EC 1.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.1 or 1.3.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>GFF977 Dihydroorotate dehydrogenase (quinone) (EC 1.3.5.2) (Sphingobium sp. HT1-2)
MSYRLIRPLFFALDAERAHNLSIALLRMMPTPAPLKADPMLAQTVAGIAFPNPVGLAAGY
DKDGRVAHKMHGLGFGFAELGTLTPLAQPGNPQPRLFRLVEDKAVINRFGFNNGGQGAAA
DRIARYRRPVGEGPVIGINIGANKEATAAGRANADYATGVTCMAPLADYLTVNISSPNTP
GLRALQGRAALDDLLGAVMAARPVGGPPIFLKVAPDLEPADIEDIAAACIDHRIDALIVS
NTTITRPALQSPHAGETGGLSGAPLTDLSLGKIKDFRRLLGDRLPLIGVGGIANAEQAYA
RIRAGASLVQVYSALVYEGPYLARRINEGLKALMARDGVRHIGEVVGIDA