Protein Info for GFF973 in Xanthobacter sp. DMC5

Annotation: Thiol:disulfide interchange protein CycY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR00385: periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily" amino acids 20 to 192 (173 residues), 164.4 bits, see alignment E=9.6e-53 PF00578: AhpC-TSA" amino acids 50 to 173 (124 residues), 47.8 bits, see alignment E=2.7e-16 PF08534: Redoxin" amino acids 51 to 186 (136 residues), 64.7 bits, see alignment E=1.7e-21 PF13905: Thioredoxin_8" amino acids 83 to 171 (89 residues), 29.4 bits, see alignment E=1.7e-10 PF00085: Thioredoxin" amino acids 84 to 180 (97 residues), 27 bits, see alignment E=7.6e-10

Best Hits

Swiss-Prot: 63% identical to CYCY_BRADU: Thiol:disulfide interchange protein CycY (cycY) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02199, cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE (inferred from 84% identity to xau:Xaut_4129)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>GFF973 Thiol:disulfide interchange protein CycY (Xanthobacter sp. DMC5)
MSDPVIAPARPRRRLWLVALPLVVFLALAALFFSRLETGGDPSRIPSALVGKKAPVVSLP
PLEGLKGPDGAPLPGIDLAALGGKPALVNVWASWCGPCREEHPILMQLGKDPRFSLVGIN
YKDAPDNARRFLGQFGLPYKAVGVDPKGRAAIEWGVYGVPETFVVSKDGTIVHKFVGPLT
PEAVSNTLLPLMARLSGG