Protein Info for GFF970 in Xanthobacter sp. DMC5

Annotation: Linearmycin resistance permease protein LnrM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details transmembrane" amino acids 201 to 221 (21 residues), see Phobius details amino acids 242 to 270 (29 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 21 to 386 (366 residues), 87 bits, see alignment E=1.4e-28 PF01061: ABC2_membrane" amino acids 202 to 359 (158 residues), 66.4 bits, see alignment E=2.8e-22

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 80% identity to xau:Xaut_4131)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>GFF970 Linearmycin resistance permease protein LnrM (Xanthobacter sp. DMC5)
MMMGAIVRAMALTLMRDRGALMMTFVLPPVLFILFAAVFAGTGGETSAIKIAAARTTDAP
SATAFLTALGHASDNDLILVTPEEVRARVADGRADVGLVVRGDVAAATDKPPLLVITDPA
RNVAAALLSARIQRVFTDDLPGLAIRRVAAQIQVLVGAFSPEQTSRLEQSIARAPELVAG
GGAELMERQPLTRRRSEPGVSYYAGAIAMLFLLFSAVQGAGSLVDERRSGVFDRIVMSRG
GVLALVGGKLAFLILQGLALSAVLFAVAQIVYGVNVLPNFWTFAAVAVAASAAAAGIALP
LAAVSRTRQQAQTLSTFAVLLLSAVGGSMVPRFLMPEWLQQAGVLTPTAWGIEAFQGALW
RGEGMATLAPSLLILLGWAAAGAAVTLWFIRRQVRLA