Protein Info for GFF970 in Variovorax sp. SCN45

Annotation: Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 5 to 76 (72 residues), 77.9 bits, E=1.9e-25
• PF01946: Thi4
  • amino acids 123 to 171 (49 residues), 27 bits, 1.1e-09
• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 125 to 595 (471 residues), 475.5 bits, E=8.1e-147
• PF01134: GIDA
  • amino acids 126 to 273 (148 residues), 34.4 bits, E=6.2e-12
• PF12831: FAD_oxidored
  • amino acids 126 to 163 (38 residues), 38.8 bits, 3.3e-13
• PF00890: FAD_binding_2
  • amino acids 126 to 160 (35 residues), 23.1 bits, see alignment (E = 1.9e-08)
• PF07992: Pyr_redox_2
  • amino acids 126 to 454 (329 residues), 194.4 bits, E=1.4e-60
• PF00070: Pyr_redox
  • amino acids 302 to 378 (77 residues), 40.9 bits, E=1.1e-13
• PF02852: Pyr_redox_dim
  • amino acids 481 to 589 (109 residues), 128.1 bits, E=7.7e-41

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 93% identity to vpe:Varpa_3727)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Protein Sequence (606 amino acids)

>GFF970 Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4) (Variovorax sp. SCN45)
MSEQQIKVPDIGDFDEVAVIEVLVNVGDTVKAEQSLITVESDKASMEIPSSAAGVVKALA
VKVGDKVKEGSVVLTLEVDGAAAPAPAAAAPAPAAAPAPKAAPAPAPASAAVAVSSYGGK
VDVECDVVVLGAGPGGYSAAFRAADLGLKVVLIERYATLGGVCLNVGCIPSKALLHVASV
MDEVKHFADLGVSFAAPTVDRAKLLGHKNKVVGKLTSGLTAMAKMRKVTVLRGVGNFIDP
YHLEVEETSGTSWDTTGSKQTVKFRNAIIAAGSQAVSLPFMPKDPRVVDSTGALEMGTDP
KRMLILGGGIIGLEMGTVYSSLGARLDVVEMLDGLMQGADRDLVKVWQKMNAPRFDNIML
KTKTVGAEATKEGIKVTFEGENAPKEPQVYDLVLQAVGRSPNGKKIGAEKAGVTVSDRGF
IPVDIQMRTNVSHIFAIGDIVGQPMLAHKAVHEAHVAAEVIAGEQKGDKELSSAAFNARV
IPSVAYTDPEVAWVGLTEDQAKAEGIKVKKGHFPWSASGRAIANGRDEGFTKLLFDAETH
RILGGGIVGTHAGDMLGEIALAIEMGADEIDIGKTIHPHPTLGESIGMAAEVAHGSCTDL
PPARKS