Protein Info for GFF97 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Chaperone protein EcpD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00345: PapD_N" amino acids 23 to 142 (120 residues), 136.6 bits, see alignment E=4.7e-44 PF02753: PapD_C" amino acids 164 to 219 (56 residues), 57.7 bits, see alignment E=1.2e-19

Best Hits

Swiss-Prot: 40% identical to FIMC_ECOL6: Chaperone protein FimC (fimC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 98% identity to sew:SeSA_A0195)

Predicted SEED Role

"Chaperone protein EcpD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>GFF97 Chaperone protein EcpD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNSLAKAGLLCCLLCGSLAHAAGINIGTTRVIFHGDAKDASISISNSDNVPYLIQSWAQS
ISETGASGDAPFMVTPPLFRLNGGQKNVLRIIRTGGNLPEDRESLYWLDIKSIPSSNPDN
KHNTLMLAVKAEFKLIYRPKALTQKPEEVADRLTWSRQGRTLTVKNPTPYYMNFATLSVG
SQKVKAPRYVAPFGNAQYTLPAAASGPIVWSIINDFGGTGPEHKQTP