Protein Info for PS417_04910 in Pseudomonas simiae WCS417

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 157 to 181 (25 residues), see Phobius details amino acids 193 to 220 (28 residues), see Phobius details amino acids 232 to 249 (18 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 155 to 251 (97 residues), 67.6 bits, see alignment E=5.6e-23 PF00528: BPD_transp_1" amino acids 172 to 355 (184 residues), 81 bits, see alignment E=4.6e-27

Best Hits

Swiss-Prot: 66% identical to YHDY_ECOLI: Inner membrane amino-acid ABC transporter permease protein YhdY (yhdY) from Escherichia coli (strain K12)

KEGG orthology group: K09971, general L-amino acid transport system permease protein (inferred from 99% identity to pfs:PFLU1002)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAK7 at UniProt or InterPro

Protein Sequence (365 amino acids)

>PS417_04910 amino acid ABC transporter permease (Pseudomonas simiae WCS417)
MSSHTFKPDMPPPNKVFGPMAWMRANLFSSWLNTLLTLLAFYLIYLVVPPILSWAIIDAN
WVGTTRADCTKEGACWVFIQQRFGQFMYGYYPGDLRWRVDLTVWLAIVGVAPLFISRFQR
KAVYGLGFLVLYPIIAFFLLHGGIFGLTNVATSQWGGLMLTLVIATVGIAGALPLGIMLA
LGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMGIDKLLRALIGVILF
QSAYVAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMGLVILPQALKMVIPGIVNTFIALFK
DTSLVIIIGLFDLLNSVKQAAADPKWLGMATEGYVFAALVFWIFCFGMSRYSIHLEHKLD
TGHKR