Protein Info for GFF968 in Sphingobium sp. HT1-2

Annotation: Iron-sulfur cluster assembly iron binding protein SufA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00049: iron-sulfur cluster assembly accessory protein
  • amino acids 15 to 120 (106 residues), 95.4 bits, E=1.1e-31
• PF01521: Fe-S_biosyn
  • amino acids 17 to 116 (100 residues), 61.2 bits, E=5.5e-21

Best Hits

Swiss-Prot: 44% identical to ISCA1_COLLI: Iron-sulfur cluster assembly 1 homolog, mitochondrial (ISCA1) from Columba livia

KEGG orthology group: K13628, iron-sulfur cluster assembly protein (inferred from 88% identity to sch:Sphch_2025)

MetaCyc: 37% identical to iron-sulfur cluster insertion protein IscA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Iron binding protein SufA for iron-sulfur cluster assembly"

Protein Sequence (120 amino acids)

>GFF968 Iron-sulfur cluster assembly iron binding protein SufA (Sphingobium sp. HT1-2)
MTETTTKTRARPAAVMLTPSAEGRIAELMAQAPEGAIGVKLSTPKRGCSGLAYSVDYVTE
EAKFDEKIETPGGVLYIDGASVLYLIGSTMNWVEDDFTAGFVFANPNAKGSCGCGESFTV