Protein Info for GFF967 in Xanthobacter sp. DMC5

Annotation: Isopentenyl-diphosphate delta-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02151: isopentenyl-diphosphate delta-isomerase, type 2
  • amino acids 8 to 340 (333 residues), 379.8 bits, E=5.2e-118
• PF01070: FMN_dh
  • amino acids 25 to 99 (75 residues), 27 bits, E=1.1e-10
  • amino acids 179 to 335 (157 residues), 44.7 bits, E=4.8e-16

Best Hits

Swiss-Prot: 80% identical to IDI2_XANP2: Isopentenyl-diphosphate delta-isomerase (fni) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K01823, isopentenyl-diphosphate delta-isomerase [EC: 5.3.3.2] (inferred from 80% identity to xau:Xaut_4134)

Predicted SEED Role

"Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis (EC 5.3.3.2)

MetaCyc Pathways

• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• isoprene biosynthesis I (8/10 steps found)
• all-trans-farnesol biosynthesis (3/4 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (6/10 steps found)
• bisabolene biosynthesis (engineered) (3/6 steps found)
• mono-trans, poly-cis decaprenyl phosphate biosynthesis (2/5 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (3/7 steps found)
• mevalonate pathway II (haloarchaea) (3/7 steps found)
• isoprene biosynthesis II (engineered) (3/8 steps found)
• mevalonate pathway III (Thermoplasma) (3/8 steps found)
• mevalonate pathway IV (archaea) (3/8 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• superpathway of ergosterol biosynthesis I (5/26 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (25/56 steps found)
• superpathway of cholesterol biosynthesis (5/38 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.3.2

Protein Sequence (343 amino acids)

>GFF967 Isopentenyl-diphosphate delta-isomerase (Xanthobacter sp. DMC5)
MDENAAGRRKEDHIDIVLSGDRVASRVDAGFDRWRFVHCALPELSLDAVDLSTSVLGRRL
KAPLLISAMTGGPARSEAINAHLAEAAQALGIALGVGSQRIAVETGAAGGLGGDLRRRAP
NVLLLANLGAAQLLAADGRDNARRAVEMIGADALVIHLNPLQEAIQEGGDRDWRGVLHAI
TGLCTNLHVPVVVKEVGFGLSAPVARRLVKCGVAALDVAGAGGTNWALVEGARGTGRTQA
LAAAFADWGIPTADAVADLRAALPDVPIIASGGIRDGVDAAKAIRLGADLVGQAAATLKA
AVTSTEAVVAHFEVLAEQLRIAAFVTGAGHLEALRSVPLVEVR