Protein Info for GFF967 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: CAIB/BAIF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 173 to 194 (22 residues), see Phobius details PF02515: CoA_transf_3" amino acids 13 to 376 (364 residues), 415.6 bits, see alignment E=9.9e-129

Best Hits

Swiss-Prot: 37% identical to SCCT_CHLAA: Succinyl-CoA--D-citramalate CoA-transferase (Caur_2266) from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)

KEGG orthology group: None (inferred from 92% identity to pol:Bpro_5285)

MetaCyc: 42% identical to succinate--lglutarate CoA-transferase (Agrobacterium fabrum C58)
Succinate--hydroxymethylglutarate CoA-transferase. [EC: 2.8.3.13]

Predicted SEED Role

"CAIB/BAIF family protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>GFF967 CAIB/BAIF family protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MGNNAPLPAFGALAGLKVIDLSRVLGGPYCGQILADHGAQVIKVEPPAGDETRAWGPPFA
DDGTAAYYNGLNRNKRDIVIDLSKPEGREIVLKMLADADVLIENFKIGTLERWGIGYEQT
LRERFPRLIHCRVSGFGADGPLGGAPGYDAVAQALGGLMSVNGTPDTGPLRVGVPVVDIT
TGLSAVIGVLLAVIERQRSGRGQFVEATLYDTAVSLLHPQSANWLQSGQTPRLSGNAHSN
IVPYDKFPTRTCEVFLGIGNNGQWKKLCEFLGHPDMASEPRFATNAERFRHRDELRALLE
AQLQEVDGEQLCRDLLAAGIPAGAVRAIPQVLTDPHTLHRDMVVQVEGVPGIGIPVKLSR
TPGRAHSAPPRFGQHTRELLTEHGYGAATIDALIARGSIVEHVAT