Protein Info for GFF962 in Xanthobacter sp. DMC5

Annotation: Hippurate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 TIGR01891: amidohydrolase" amino acids 15 to 371 (357 residues), 346.4 bits, see alignment E=1e-107 PF01546: Peptidase_M20" amino acids 74 to 381 (308 residues), 160.3 bits, see alignment E=6.3e-51 PF07687: M20_dimer" amino acids 187 to 282 (96 residues), 36.2 bits, see alignment E=4.9e-13

Best Hits

Swiss-Prot: 40% identical to CBPX1_SACS2: Thermostable carboxypeptidase 1 (cpsA1) from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 86% identity to xau:Xaut_4367)

MetaCyc: 41% identical to N-acetyl-sulfur-metabolite deacetylase (Bacillus subtilis subtilis 168)
3.5.1.-

Predicted SEED Role

"N-acetyl-L,L-diaminopimelate deacetylase (EC 3.5.1.47)" in subsystem Lysine Biosynthesis DAP Pathway (EC 3.5.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.32 or 3.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>GFF962 Hippurate hydrolase (Xanthobacter sp. DMC5)
MPVNNHIAARADEIAAWRQDFHRHPELMYDLDRTSASVAEKLRAFGCDEVITGIGRTGVV
GIVRGKGDGPLIGLRADMDALPIVEKTGAAYASQTPGKMHACGHDGHTAMLLGAARHLAE
TRAFSGTAVLIFQPAEEGGAGAKAMINDGLFTRFPVREVYGMHNLPGLEVGRFAMRPGGI
MASADHIEIVVDGRGAHAARPNQGVDVVLTGAAIVMALQQIVSRNVDPLEAAVVSIAMFH
AGEADNVLPPSATLVGTARTLDQGVRAQLRERIRQVAEGVAAAYGATATVSFKEGYPVTS
NHPDQVAFAAEVASEVAGASEVDAAAPPLMAAEDFAYMLEEKPGAYIFIGNGPSAGLHHP
QYDFADAAIPYGASYWVRLVERALPLTA