Protein Info for GFF961 in Sphingobium sp. HT1-2

Annotation: Cytochrome b561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 3 to 170 (168 residues), 109 bits, see alignment E=1.2e-35

Best Hits

KEGG orthology group: K12262, cytochrome b561 (inferred from 72% identity to sjp:SJA_C1-33710)

Predicted SEED Role

"Cytochrome B561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>GFF961 Cytochrome b561 (Sphingobium sp. HT1-2)
MARYTSVARLLHWIIAILILVNLWLGFAHDSLPKEWKVMPVHKSIGLTVLALTILRIVWR
LGHKPPALPSAMPGWEKLAANLTHIAFYAFMLIVPLSGWIMSSAGERPLNWFFLFDVPKF
GVAKGDAIVGISHEAHGLIPWLWSALIIVHILAALRHHFMLKDGVLRRML