Protein Info for PS417_04870 in Pseudomonas simiae WCS417

Annotation: molybdenum cofactor biosynthesis protein MoaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 80 TIGR01682: molybdopterin converting factor, subunit 1" amino acids 3 to 80 (78 residues), 66.2 bits, see alignment E=1.9e-22 PF02597: ThiS" amino acids 5 to 80 (76 residues), 59.9 bits, see alignment E=1.5e-20

Best Hits

Swiss-Prot: 49% identical to MOAD_HAEIN: Molybdopterin synthase sulfur carrier subunit (moaD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03636, molybdopterin synthase sulfur carrier subunit (inferred from 92% identity to pfs:PFLU0996)

MetaCyc: 48% identical to molybdopterin synthase sulfur carrier subunit (Escherichia coli K-12 substr. MG1655)
RXN-8342 [EC: 2.8.1.12]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaD" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TV09 at UniProt or InterPro

Protein Sequence (80 amino acids)

>PS417_04870 molybdenum cofactor biosynthesis protein MoaD (Pseudomonas simiae WCS417)
MSINVLFFARYAEAVGFDSLEMEGDFATVDAVRLALASDPAFAVLNETSLMCARNEELCD
LEEPVQAGDDVAFFPPVTGG