Protein Info for GFF957 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Alcohol dehydrogenase (EC 1.1.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF08240: ADH_N" amino acids 28 to 137 (110 residues), 92.5 bits, see alignment E=3e-30 PF01262: AlaDh_PNT_C" amino acids 168 to 241 (74 residues), 30.3 bits, see alignment E=5.7e-11 PF00107: ADH_zinc_N" amino acids 179 to 300 (122 residues), 89.5 bits, see alignment E=3.6e-29 PF13602: ADH_zinc_N_2" amino acids 211 to 335 (125 residues), 30 bits, see alignment E=1.9e-10

Best Hits

Swiss-Prot: 92% identical to AHR_ECOLI: Aldehyde reductase Ahr (ahr) from Escherichia coli (strain K12)

KEGG orthology group: K12957, uncharacterized zinc-type alcohol dehydrogenase-like protein [EC: 1.-.-.-] (inferred from 99% identity to seg:SG4310)

MetaCyc: 92% identical to NADPH-dependent aldehyde reductase Ahr (Escherichia coli K-12 substr. MG1655)
Alcohol dehydrogenase (NADP(+)). [EC: 1.1.1.2]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.1

Use Curated BLAST to search for 1.-.-.- or 1.1.1.1 or 1.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>GFF957 Alcohol dehydrogenase (EC 1.1.1.1) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTIIKSYAAKEAGGELELYEYDAGELQPEDVEVRVDYCGICHSDLSMIDNEWGFSQYPLV
AGHEVIGRVAALGSAAQDKGLKVGQRVGIGWTARSCGHCDACISGNQINCQEGAVPTILN
RGGFAEKLRAGWQWVIPLPENIDMASAGPLLCGGITVFKPLLMHHITATSRVGVIGIGGL
GHIAIKLLHAMGCEVTAFSSNPSKEQEVLAMGANNVVNSRDPEALKALAGQFDLIINTVN
VDLDWQPYFEALTYGGNFHTVGAVLKPLPVPAFTLIAGDRSISGSATGTPYELRKLMKFA
GRSKVAPTTELFAMSQINEAIQHVRDGKARYRVVLKADF