Protein Info for PS417_04850 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF03883: H2O2_YaaD" amino acids 1 to 243 (243 residues), 311.3 bits, see alignment E=2.2e-97

Best Hits

Swiss-Prot: 96% identical to Y992_PSEFS: UPF0246 protein PFLU_0992 (PFLU_0992) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K09861, hypothetical protein (inferred from 96% identity to pfs:PFLU0992)

Predicted SEED Role

"UPF0246 protein YaaA" in subsystem YaaA

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2G1 at UniProt or InterPro

Protein Sequence (259 amino acids)

>PS417_04850 hypothetical protein (Pseudomonas simiae WCS417)
MLMVISPAKTLDFETAPATQRFTQPQYLDHSQELIEQLREFSPAQISELMHVSDKIGGLN
AARFGSWTPAFTPANAKQALLAFKGDVYTGLNADTFSDADFSYAQDHLRMLSGLYGLLRP
LDLMMPYRLEMGTKLPNARGKDLYAFWGTRISEWLNEALAEQGDDVLLNLASNEYFSAVK
RTALNARIINTEFKDLKNGQYKIISFYAKKARGMMSRFVIEERINDPAKLKAFDVQGYRF
NAEQSKPDNLVFLRDHAPE