Protein Info for GFF956 in Sphingobium sp. HT1-2

Annotation: AAA family ATPase Cdc48

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 764 TIGR01243: AAA family ATPase, CDC48 subfamily" amino acids 12 to 743 (732 residues), 926 bits, see alignment E=2.5e-282 PF02359: CDC48_N" amino acids 13 to 94 (82 residues), 78.5 bits, see alignment E=4e-25 PF02933: CDC48_2" amino acids 113 to 195 (83 residues), 42.4 bits, see alignment E=5.1e-14 PF13191: AAA_16" amino acids 239 to 347 (109 residues), 33.7 bits, see alignment E=5.8e-11 PF07728: AAA_5" amino acids 243 to 361 (119 residues), 24.2 bits, see alignment E=3.3e-08 PF00004: AAA" amino acids 244 to 373 (130 residues), 152.8 bits, see alignment E=8.3e-48 amino acids 518 to 648 (131 residues), 147.4 bits, see alignment E=3.7e-46 PF17862: AAA_lid_3" amino acids 397 to 435 (39 residues), 44.4 bits, see alignment 1.1e-14 amino acids 671 to 717 (47 residues), 50.7 bits, see alignment 1.1e-16

Best Hits

KEGG orthology group: K13525, transitional endoplasmic reticulum ATPase (inferred from 93% identity to sch:Sphch_2014)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (764 amino acids)

>GFF956 AAA family ATPase Cdc48 (Sphingobium sp. HT1-2)
MTMADQDSSGRRIQVANARPEDAGRGLARLPLTVMAELQLAEGDVVEIVGKRSTPARVVR
PYKEDEGLDVLRLDGLQRANAGVGSGDFVQLRKIDPRPAQRVVFAPAQNNLRLQGNPDAL
KRVFFQRPLVAGDVVATAGQQQVPPGDMPPHLRQMLAAPAYALQEIRLIVVSTVPKGIVH
IDAETEVELRAEYEEPRESRRADVTYDDVGGMAETIDQLREMVELPLRYPELFERLGVDP
PKGVMLHGPPGTGKTRLARAVANESEAEFFLINGPEIMGSAYGESEKKLRDIFEEAAKAA
PSILFIDEIDSIAPKRGQVTGETEKRLVAQLLTLMDGLEPRTNLVVIAATNRPEAIDEAL
RRPGRFDREIVVGVPDERGRREILGIHTRGMPLGDRVDLAELARMTYGFVGADLAALTRE
AAIETVRRLMPRLNLEEGTIPPDVLEDLSVTREDFLSAIKRVQPSAMREVMVQAPNIGWA
DIGGLDDAQMRLKEGVELPLKDPDAFRRLGIRPAKGFLLYGPPGTGKTLLAKAVAREAQA
NFIATKSSDLLSKWYGESEQQIARLFARARQVAPTVIFIDELDSLVPARGGGLGEPAVTE
RVVNTILAEMDGLEELQSVVVIGATNRPTLVDPALLRPGRFDELIYVPVPDQAGRKRILA
IHTKKMPLASDVDLDQLAARTERFTGADLEDLSRRAGLIALRQSLQVEAVTMAHFEAALE
ETRASVTPEMEREYEQIQATLKQSAMQVDPIGFIAPGMLRARER