Protein Info for PS417_04845 in Pseudomonas simiae WCS417

Annotation: GDP-mannose dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03026: nucleotide sugar dehydrogenase" amino acids 1 to 419 (419 residues), 462.9 bits, see alignment E=4.3e-143 PF03721: UDPG_MGDP_dh_N" amino acids 1 to 189 (189 residues), 197.1 bits, see alignment E=3.2e-62 PF00984: UDPG_MGDP_dh" amino acids 205 to 298 (94 residues), 100.1 bits, see alignment E=9.5e-33 PF03720: UDPG_MGDP_dh_C" amino acids 317 to 420 (104 residues), 52.3 bits, see alignment E=1e-17

Best Hits

Swiss-Prot: 92% identical to ALGD_PSESY: GDP-mannose 6-dehydrogenase (algD) from Pseudomonas syringae pv. syringae

KEGG orthology group: K00066, GDP-mannose 6-dehydrogenase [EC: 1.1.1.132] (inferred from 98% identity to pfs:PFLU0990)

MetaCyc: 77% identical to GDP-mannose 6-dehydrogenase (Pseudomonas aeruginosa)
GDP-mannose 6-dehydrogenase. [EC: 1.1.1.132]

Predicted SEED Role

"GDP-mannose 6-dehydrogenase (EC 1.1.1.132)" in subsystem Alginate metabolism (EC 1.1.1.132)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.132

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TWB1 at UniProt or InterPro

Protein Sequence (438 amino acids)

>PS417_04845 GDP-mannose dehydrogenase (Pseudomonas simiae WCS417)
MRISIFGLGYVGAVCAGCLSARGHEVVGVDISKDKIDLINAGKSPIVEPGLGELLSQGIE
TGRLRGTTNFAEAIRDTDLSMICVGTPSKKNGDLELDYIEAVCREIGLVLRDKATRHTVV
VRSTVLPGTVANVVIPILEDCSGKKAGVDFGVAVNPEFLRESTAIADYDLPPMTVIGEFD
KASGDVLQSLYEELDAPIIRKDIAVAEMIKYTCNVWHATKVTFANEIGNIAKAVGVDGRE
VMEVVCQDKTLNLSQYYMRPGFAFGGSCLPKDVRALTYRASSLDVEAPLLNSLMRSNESQ
VQNAFDIVSSHDKRKVALLGLSFKAGTDDLRESPLVELAEMLIGKGFDLSIYDSNVEYAR
VHGANKDYIEGKIPHVSSLLNSDFDDVINNSDVIILGNRDEKFRALAHNAPHGKQVIDLV
GFMANATSAGSRTEGICW