Protein Info for PS417_04835 in Pseudomonas simiae WCS417

Annotation: hemolysin D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 158 to 181 (24 residues), see Phobius details PF07238: PilZ" amino acids 16 to 115 (100 residues), 49.2 bits, see alignment E=8.9e-17 PF13437: HlyD_3" amino acids 261 to 356 (96 residues), 40.8 bits, see alignment E=5e-14

Best Hits

Swiss-Prot: 73% identical to ALG44_PSESM: Alginate biosynthesis protein Alg44 (alg44) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU0988)

MetaCyc: 57% identical to mannuronosyl transferase regulatory subunit (Pseudomonas aeruginosa)
Alginate synthase. [EC: 2.4.1.33]

Predicted SEED Role

"Alginate biosynthesis protein Alg44"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UD63 at UniProt or InterPro

Protein Sequence (388 amino acids)

>PS417_04835 hemolysin D (Pseudomonas simiae WCS417)
MNSQVNANVVHESEAQRQHARVKIPAKLRFFNTDRTQTEARVIDLSAGGLAFTATQPLTV
GEVHKGRLQFVIDNLGLAMDVELQIRSYDRQSGRTGCQFQNLDAQDISTLRHLITSHLSG
DIVTMGDVLATLQRDNFTKARKVKDGGSNMSAFGRLRAVTFSLAIFLVGLAAFGFVFKSI
YGMYFVSHAQAGLVNVPGMNVTMPRDGTVQSLLKGDGIAAKGAPLATFSTSMLDVLKGHL
DEDQLQPAKVEELFGKQMTGTLTSPCDCVVAQQMVADGQYANKGDVIFQLVPRGSLANVE
ARFTYRQFADVRPGTPVSFQVADEEQIRTGTIVSSTSLNSADLSSDIRVQIKPDAPLDST
YAGRPVEVTSDRGPSLNWLIDKAMAHGL