Protein Info for GFF952 in Methylophilus sp. DMC18

Annotation: NADH-quinone oxidoreductase subunit M

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details amino acids 410 to 431 (22 residues), see Phobius details amino acids 457 to 476 (20 residues), see Phobius details TIGR01972: proton-translocating NADH-quinone oxidoreductase, chain M" amino acids 12 to 491 (480 residues), 613.1 bits, see alignment E=1.7e-188 PF00361: Proton_antipo_M" amino acids 138 to 421 (284 residues), 261.7 bits, see alignment E=4.1e-82

Best Hits

Swiss-Prot: 44% identical to NUOM_RICPR: NADH-quinone oxidoreductase subunit M (nuoM) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K00342, NADH dehydrogenase I subunit M [EC: 1.6.5.3] (inferred from 77% identity to mfa:Mfla_2049)

MetaCyc: 39% identical to NADH:quinone oxidoreductase subunit M (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain M (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>GFF952 NADH-quinone oxidoreductase subunit M (Methylophilus sp. DMC18)
MMQADLTSISWLSLAVWLPVLSGVLVLLLGGDQKATLTRWLALVGSLVSFLVTVPLYTQF
DIHDGFFQFEELLPWVPAFNMHYHLGVDGFSMPLVLLTSFTTVIVVLAGWEVITKHVAQY
MAAFLIMSGIMIGVFTALDAILYYVFWEAMLIPMFLVIGIWGGPNRVYATIKFFLYTLLG
SLLMLVAFIYLYHQTGSFELADYYLLPLSLQAQIYIFIAFFMAFAVKIPMWPVHTWLPDA
HVEAPTGGSVVLAAIALKLGGYSFLRFAMPIAPDAAHYFTSAMVALSLIAVVYIALVALV
QKDMKKLIAYSSISHMGFVTLGFFMFSQLALEGALVQMISHGFISSAMFLSVGVLYDRVH
SREISAYGGVVNKMPVFAAFAVLFAMANSGLPGTSGFVGEFMVILAAVKFNFWVAFFAAT
TLIFGAAYTLWMTKRVFFGNVTNHHVAELSDLSKREFLILGILAILVIGFGVYPQALTEV
MQATSTEFLKHMAISKLPVTGY