Protein Info for GFF942 in Variovorax sp. SCN45

Annotation: Iron-sulfur cluster-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 4 to 147 (144 residues), 185.1 bits, see alignment E=4.9e-59 PF04060: FeS" amino acids 12 to 44 (33 residues), 51.8 bits, see alignment 2.1e-17 PF13237: Fer4_10" amino acids 77 to 125 (49 residues), 29.9 bits, see alignment E=1.8e-10 PF14697: Fer4_21" amino acids 77 to 131 (55 residues), 64.2 bits, see alignment E=3.8e-21 PF00037: Fer4" amino acids 78 to 99 (22 residues), 30.3 bits, see alignment (E = 1e-10) amino acids 108 to 130 (23 residues), 24.5 bits, see alignment (E = 7e-09) PF13187: Fer4_9" amino acids 84 to 129 (46 residues), 28.2 bits, see alignment 6.4e-10 PF12838: Fer4_7" amino acids 84 to 128 (45 residues), 31.5 bits, see alignment 8.1e-11

Best Hits

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 82% identity to vpe:Varpa_3754)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>GFF942 Iron-sulfur cluster-binding protein (Variovorax sp. SCN45)
VIGLAARINDALPQTQCTRCGYPDCASYAQAVADGEAGINQCPPGGAEGIERLARLTGRA
PLPLDPECGIEGPRAMAVIDEAWCIGCTLCLDACPTDAIVGINKRMHTVIEAHCTGCELC
IPVCPVDCISLEVETPGSTGWQAWSAEQAASARRRYDLHGKHRNTDARLAEKPPEADAPQ
DASARKRAIVEAALARARAASQQRAQAANKP